This article helps Intune administrators understand and troubleshoot problems when enrolling iOS/iPadOS devices in Intune. { "useCountToKudo" : "false", // if the target of the click isn't the container and not a descendant of the container then hide the search Pan-Os; Global protect; Windows. Create CNAME DNS resource records for your companys domain. Updated 11:52 AM CDT, Fri May 7, 2021. sudo apt-get install -only-upgrade mdatp. "action" : "rerender" "action" : "rerender" \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e43036b17', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '7u_ifnBN0AIgD2oe7gJl2BHG-coVHdLJ7PmFutnSr9s. { }, { { I'm seeing this problem on my iPhones with the newer iOS - with or without using Quick Start or restoring from a backup. "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); I think the profile manager still thinks the devices are managed. Don't replace the APNs certificate. } ], LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pxV3WvuAKBChK7q8SEva40F6S5XmS4he6kgOOBAZ2TU. "actions" : [ Apple's MDM Certificate (APNs) is required for enrolling Apple devices. "context" : "envParam:quiltName", } We do not have this problem anymore. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetMessageEdit", ] Press question mark to learn the rest of the keyboard shortcuts. { "context" : "envParam:quiltName", "context" : "envParam:quiltName,product,contextId,contextUrl", "}); }, { ] "entity" : "153010", } "action" : "rerender" ] ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ I have checked intune management portal and there are no other users registered with this device. I just wondered what that error actually mean. } I do feel there may be something cached in that backup causing the issue though. ', 'ajax'); { "action" : "rerender" "event" : "ProductAnswer", "context" : "", } "kudosable" : "true", { Cause: Your Intune tenant is configured to only allow corporate-owned devices. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "context" : "", Remove the Company Portal app from the device. How many users are affected? "}); Under Device Type Restrictions, select the restriction that you want to set > Properties> Select platforms > select Allow for iOS, and then click OK. }, { "truncateBody" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" }, Now after the blueprint and profiles are loaded onto the devices via the MDM, I try to enroll them and get "Profile Installation Failed - The SCEP server returned an invalid response". ] "event" : "addThreadUserEmailSubscription", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ }, Description: The same basic health output that is shown when running mdatp health command. ] Verify that a valid APNs certificate is added to Intune. Troubleshooting iOS/iPadOS device enrollment problems in Microsoft Intune. Fix the connection issue, or use a different network connection to enroll the device. "useCountToKudo" : "false", "disableKudosForAnonUser" : "false", if ( /^((?!chrome|android). { "eventActions" : [ "action" : "rerender" "selector" : "#messageview", A tag already exists with the provided branch name. Solution: Sign in to the Microsoft Endpoint Manager admin center. Continue to have the same error? } Privacy Policy. "actions" : [ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_b79a2e42c50455","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_b79a2e42c50455_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sNJ9SQJ9RKjLmL5zcfjUFeCgpa5jCM48VZGnEMm53wE. Getting "profile installation failed". "actions" : [ The solution was to Delete (Remove From Network) the laptop from the list of Devices in Meraki Systems Manager. Intune iOS/iPadOS Intune - Intune Intune iOS iPadOS iOS iPadOS Intune - Intune iOS/iPadOS Microsoft Intune Intune - Intune Microsoft Intune Intune iOS/iPadOS - Microsoft Intune Intune iOS/iPadOS Show more ] "actions" : [ Failed to update Apple DEP view When you turn on a DEP-managed device that is assigned an enrollment profile, the initial setup sticks after you enter credentials. ] Select Device enrollment> Enrollment restrictions. "event" : "removeThreadUserEmailSubscription", ] "showCountOnly" : "false", { The purpose is to update the modification time of the profile. A Intune Bluetooth profile restrictions, failed paired Intune Management Extension - hard reboot during ESP not Intune MDM IOS devices setup assistant with modern Intune managed apps - None are installing (All show "0x0" Well, it's been fun guys. { "selector" : "#messageview_0", This user account is not authorized to use Microsoft Intune. "event" : "AcceptSolutionAction", { Scroll down to Enrollment Restrictions > Device Models allowed, check the box corresponding to macOS. '; I have an iPad configured in Kiosk mode and locked in with single app Edge browser. "useSubjectIcons" : "true", "disableLabelLinks" : "false", "context" : "", Can anyone tell me what is this error mean and direct me where to troubleshoot next? { "actions" : [ Edit: do you have the same issue with wireless turned off? Remove and reinstall the Norton Family profile From the Home screen, go to Settings, and then go to General. "action" : "rerender" ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); { The error is from Intune - Software Updates - Installation failures for iOS devices. "context" : "", Usually, I update them over the weekend to make sure I have at least 24-36h. "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InlineMessageEditor({"ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","submitButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Submit-action"}); { If we understand correctly, you are unable to install a profile on this Mac. "useTruncatedSubject" : "true", ] "context" : "envParam:viewOrderSpec", Company Portal Temporarily Unavailable. "actions" : [ Contact your system administrator if you think you have received this message in error. "actions" : [ The storage is fine. { Best practices and the latest news on Microsoft FastTrack, The employee experience platform to help people thrive at work, Expand your Azure partner-to-partner network, Bringing IT Pros together through In-Person & Virtual events. { ] }, Once I get to homescreen after modern auth completed, I see all apps installing and I can see device management profile installed. "selector" : "#kudosButtonV2_0", }, "useSubjectIcons" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e44cf7ff0', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '5YmFWesEZCs1xIhYTOuXo5xYJxETXacdR2O6yUFTaI8. ANother possibility would be to delete the registry key which controls if the app is installed or not HKEY_LOCAL_MACHINE\SOFTWARE\Microsoft\IntuneManagementExtension\Win32Apps\ {SID}\ {App GUID} If the exit code is not zero its failed. I also configured an iOS update policy to update the iOS from 12.4.6 to 13.0.0. }, } Sign in to the Azure portal. "action" : "rerender" You might be connecting to a server that is pretending to be "<myserver>.local" which could put your confidential information at risk. "kudosLinksDisabled" : "false", delete that appguid registry key 0 Likes Reply } "context" : "envParam:quiltName,expandedQuiltName", } "event" : "removeThreadUserEmailSubscription", "action" : "rerender" ] } "event" : "addThreadUserEmailSubscription", Are all users affected or just some? "}); )*safari/i.test(navigator.userAgent)) { }, Find and tap the Settings icon. { "actions" : [ "parameters" : { Complete the following steps to remove the existing management profile. "context" : "envParam:selectedMessage", "useSortHeader" : "false", Which means enrollment will fail on the new device because there's already a profile there when it tries to install the new/correct one. "event" : "ProductMessageEdit", When you turn on a DEP-managed device that is assigned an enrollment profile, the Intune enrollment process isn't initiated. }, } I also completely removed a couple of the affected devices from DEP and still seeing the same thing. Are you sure you want to proceed? ], ] "actions" : [ [!IMPORTANT] ] { If that fails, validate that the user's credentials have synced correctly with Azure Active Directory. To fix this problem, remove and reinstall the Norton Family profile on your iOS device. { { "event" : "ProductMessageEdit", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 's9WJ1otgrWjdFDJSAJrv7vZWgtPg4QRI0WZxTmRJa64. { } LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); User Name Not Recognized. You will see there is a profile already installed. } If enrollment still fails, remove cookies in Safari (don't block cookies), then re-enroll the device. { "action" : "rerender" The CNAME resource records must contain the following information: If your company uses multiple domains for user credentials, create CNAME records for each domain. LITHIUM.AjaxSupport.ComponentEvents.set({ I believe it was only email profiles but strange things happened before . } LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. { "context" : "envParam:entity", } Could you please someone help me to solve that? } After that, I had no trouble re-joining the laptop into Meraki MDM. }, "context" : "envParam:feedbackData", Profile installation failed Profile installation failed due to the following error "A connection to the server could not be established" I was trying to download management profile for company portal I am getting error while installing please let me know how can I resolve it iPhone XS, iOS 14 Posted on Aug 4, 2021 12:00 AM Reply Me too (97) { { { LITHIUM.AjaxSupport.ComponentEvents.set({ the resolutions steps for Device Cap Reached below if these steps do not resolve the issue. "kudosable" : "true", "event" : "markAsSpamWithoutRedirect", Profile Manager User Guide - Apple Support. Create an APNs Certificate for iOS/iPadOS devices, Check the Microsoft Intune Support Team Blog, Check the Microsoft Enterprise Mobility and Security Blog, EnterpriseEnrollment-s.manage.microsoft.com, EnterpriseRegistration.company_domain.com. LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "addMessageUserEmailSubscription", Right click the Windows icon in the bottom left corner and. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_b79a2e42c50455","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_b79a2e42c50455_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sNJ9SQJ9RKjLmL5zcfjUFeCgpa5jCM48VZGnEMm53wE. LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "action" : "rerender" "initiatorBinding" : true, { 750 devices only about 12 are effected. LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_b79a2e42c50455","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"meraki|category":{"title":"Search Community: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise-mobility-management|forum-board":{"title":"Search Board: Mobile Device Management","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_b79a2e42c50455_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); Resolution. Just a side note, this is a brand new mac. They are currently reviewing my configuration. } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9Vfa4gwPC75Jy8gFeXEu58IH3dCAROp0blrkZnIAfyQ. } Select Devices > Enroll devices > Enrollment restrictions. LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; ] "action" : "rerender" 5. ] So they can try to install the app from the company portal. "action" : "rerender" "parameters" : { } So I tried downloading the profile from the Meraki Portal-Manage-Add Devices-iOS for Apple Configurator. Microsoft Intune https: .. "/> detroit antique mall; hurricane 232 fundeck boat; bitcoin halving 2024 prediction; how to unlock google pixel without losing data; aura photography dallas. "initiatorDataMatcher" : "" "event" : "MessagesWidgetEditAction", ] { } "}); Tap Remove management and then tap Remove management again to confirm. This has been an ongoing issue for us for about 2 months now, still just a small selection of devices this is occurring on (Also in US). "actions" : [ "initiatorBinding" : true, "context" : "envParam:feedbackData", "disableKudosForAnonUser" : "false", "event" : "deleteMessage", "action" : "addClassName" { "event" : "addMessageUserEmailSubscription", }, { I didn't time it. ] "context" : "", $search.find('input.search-input').keyup(function(e) { "event" : "QuickReply", } { This was a surprise, because normally it's not necessary to delete device entries, as they automatically merge based on serial number. "truncateBody" : "true", { "event" : "ProductAnswerComment", I need to move all our iPhones/iPad MDM profiles in the company to a new Intune profile and remove the old MDM profile, for doing this, I am removing the old profile first and then taking a backup with iCloud and then restoring it to the factory setting, this allows me to install the new profile, but firstly I restored the taken backup with include and then. "eventActions" : [ If no enrollment CNAME record is found, users are prompted to manually enter the MDM server name, enrollment.manage.microsoft.com. Did you figure this out, seeign the same on many of our iPads iOS Update Installation Failure - Status -2016330697, Microsoft Intune and Configuration Manager, Re: iOS Update Installation Failure - Status -2016330697. iPad is not locked in kiosk mode and not running any app, basically, the screen needs to be off. Get notified when there are additional replies to this discussion. That is initially what I thought as well but since we are in the process of switching MDMs from AirWatch to InTune, I attempted to enroll back in AW and it works just fine, profile installs as it should and we received no errors. } On the device, open the browser, browse to https://portal.manage.microsoft.com, and try a user login. }); }, Profile installation failed - The SCEP server returned an invalid response There are multiple reasons for this error, like wrong timezone settings on a device or some WiFi network issue. For more information about how to restore iOS/iPadOS devices, see, Select the user account that you want to assign an Intune user license to, and then choose, If the MDM push certificate isn't configured, follow the steps in, If the MDM push certificate is invalid, follow the steps in. "actions" : [ See attachment topic01.png. ] Not necessarily just iPhone 11 - have some 7 and 8's doing the same thing. Issue 1: The VPN profile isn't deployed to the device For Android For iOS For Windows Issue 2: The VPN profile is deployed to the device, but the device can't connect to the network Typically, this is not an Intune issue. ] $search.removeClass('is--open'); ] You may choose another option from the dropdown menu. "messageViewOptions" : "1111110111111111111110111110100101011101", So I created new profile under same Enrollment program token > Assigned test device and try to enroll. You can make any change to the profile. "event" : "MessagesWidgetEditAnswerForm", "context" : "", "action" : "rerender" $search.addClass('is--open'); "actions" : [ Go to Preferences and look at this configuration profile. "actions" : [ "actions" : [ "disableLinks" : "false", If the device still doesn't work after switching to a different WiFi network, or a cellular network, please do a factory reset to fix it. "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "actions" : [ "showCountOnly" : "false", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_b79a2e42c50455_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", ","messageActionsSelector":"#messageActions_0","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_0","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "context" : "envParam:quiltName", "actions" : [ } Sometimes we still see the same error code but that doesn't mean much. "action" : "rerender" If there's more than one verified domain, create a CNAME record for each domain. "event" : "ProductAnswer", "actions" : [ Solution varies depending on your setup. Open Settings on the iOS/iPadOS device > General > VPN & Device Management. } }, "context" : "envParam:entity", LITHIUM.Placeholder(); "actions" : [ { Changes to DNS records might take up to 72 hours to propagate. "parameters" : { "event" : "MessagesWidgetAnswerForm", But it updated smoothly to 15.3.1. "useTruncatedSubject" : "true", ] ] "event" : "QuickReply", The client is supported for CentOS, Red Hat Enterprise Linux, and Ubuntu. "context" : "", { Select Device enrollment > Enrollment restrictions. "context" : "", "action" : "pulsate" "event" : "removeMessageUserEmailSubscription", WIndows Intune - AGENT INSTALL FAILED. "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "", }, { Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79a2e42c50455_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", "parameters" : { "actions" : [ "initiatorBinding" : true, }, Intune docs online show that this error could be related to our organization allowing only corporate devices, this is not correct and has been verified many times that we allow both personal and corporate devices to enroll. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bn7l5sRu1uFNIwskIQXkemjiZsAni-QamJhCbLxj0Qk. "context" : "", }, "action" : "rerender" }, ","messageActionsSelector":"#messageActions","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); You can't verify the DNS change in Intune until the DNS record propagates. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); }, LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_b79a2e42c50455', 'enableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '1F4lvtiRRNcioC0AV6722m92RAZqrsmAHuuwvW_h2dc. "actions" : [ Archived Forums 701-720 > Microsoft Intune. Step 1: Click "System Preference" in your Mac device. Cause: A management profile is already installed on the device. "action" : "rerender" ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); ] LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "context" : "", "event" : "kudoEntity", Thanks for the suggestion though! "actions" : [ [!NOTE] { [!NOTE] { ] "action" : "rerender" If there is no Profiles option, please start the installation process from the beginning. 3. "actions" : [ "quiltName" : "ForumMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } I have a handful of users experiencing this issue on iOS (<1%) when attempting to install the management profile. ","type":"POST","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=recommendations/contributions/page"}, 'lazyload'); }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddisplay_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddisplay_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"e3yp8hUhRaAhBycx7W1KjM2klVAJTXlmFF4iVH2i0zE. "disallowZeroCount" : "false", } "}); "action" : "pulsate" "event" : "AcceptSolutionAction", IIRC there was or is some service degradation in regards to the pushing of email profiles (in west Europe). "viewOrderSpec" : "XJQ9RpXExyzPSmKsjKyFS_BCHJXJCa_RaQbQcqCCvxPvMAlhjS9edUZ78z_bVz7BcWTRnP91zdZTxettzVC--_eXOWhamlBcFX2T014UoFaOt99Kx_nPW9TFWMBs0MA_dIqEdFHq9HSZSQeZzrpru6EYUuIrM9zVYRjX4mqZdcNXBsh2O5TlPdan9kiQ0KaDZYMWFJLuE5GzUuGr6Za-j_uvvwwNLvrNPmRqJlngajWF-Jd0v8ea4xF2z3Qt-ptGyzShNOL9CgbU9hKacXQSZMVN6odUTLYlC7u_PHMJfIbGc7SHz2rqaul-gguGfRkTa0HJ1pRM1wTpnwalFSBnvUrldTa465J8L_YekX8xnsmD0Rpptf1HNsNkeD9H0RK-3Yx6VkeXt7qPUWUHjxuqbX4pQYRQ7qjk3rfzW4_v5dfEN3KK_81f6bIyKBoiCEcW7MSEBRDyziEcWtGjbociI_IdUj7gEbv9TCLdLtFDwM5ZDw_le3sNEqMp5p2XYminXxEqZwT06s3X5J3lGKwcWaW1vqeYS5ujTojcapjHQfM." "actions" : [ "action" : "rerender" "event" : "approveMessage", } ] Welcome to Unlocksource : Its all about Tech, Mobile Reviews & SolutionsGuys Please Like The Video And Comment SubscribeThanks For Watching I do not know but as the iPad doesn't display anything while in the kiosk mode. "event" : "QuickReply", ] [!NOTE] Because every enrolled device consumes an Intune license, we recommend that you always remove unnecessary devices first. LITHIUM.Cache.CustomEvent.set([{"elementId":"link_4","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":7,"selectedLabel":"enrollment","title":"Enrollment"}},{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":33,"selectedLabel":"ios","title":"iOS"}},{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":44,"selectedLabel":"macos","title":"macOS"}}]); "event" : "unapproveMessage", Tap General and scroll down until you see Profiles. "actions" : [ }); "disableKudosForAnonUser" : "false", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); { "event" : "kudoEntity", } "event" : "removeMessageUserEmailSubscription", ] Did you check the Intune service health? { "context" : "", ] "eventActions" : [ You can see the part of the unique string, in this case it starts with 'deb476.'. You signed in with another tab or window. { Intune iOS DEP - Profile installation failed Hi, We are already using Intune IOS DEP with Company portal auth and user affinity which have worked fine. { "action" : "rerender" { ] "context" : "", } Many Git commands accept both tag and branch names, so creating this branch may cause unexpected behavior. ] "entity" : "153010", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ Sharing best practices for building any app with .NET. LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Options. This process includes the following steps: You create a Wi-Fi profile that includes the settings that connect to the Contoso Wi-Fi wireless network. "actions" : [ { "quiltName" : "ForumMessage", [!NOTE] "actions" : [ { This information can help you better understand the problem and reduce the time to find a resolution. "selector" : "#kudosButtonV2", { "actions" : [ { Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. "actions" : [ "actions" : [ } "context" : "envParam:quiltName,expandedQuiltName", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eFxdWROobtTwtS4xiJDLh8JdO2uZorQHJfNszbQfZ8Y. So I created new profile under same Enrollment program token > Assigned test device and try to enroll. "event" : "MessagesWidgetMessageEdit", "linkDisabled" : "false" { Very bizarre. Select More Services, search for Intune, and then select Intune. Resolution Sign in to the Azure portal. "actions" : [ The issue is not solved with a device wipe, re-enrollment, group membership re-add, etc. { { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_b79a2e42c50455","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_b79a2e42c50455_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { { Connection to the server could not be established. "action" : "rerender" To see what an enrolled iOS based device is using, tap through the following path: }, "messageViewOptions" : "1111110011111111111110111110100101111101", "context" : "envParam:quiltName,message", ] Error: Profile Installation Failed. { "context" : "", "truncateBodyRetainsHtml" : "false", { "action" : "pulsate" { { { "context" : "", } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'd8kKqEfzwnTiuwrjw1cKfnjk59HGNUektIoksUajILs. "eventActions" : [ { This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository. ] "useSubjectIcons" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "}); } } }, Profile Installation Failed. "disableLabelLinks" : "false", Then, you want to set up all iOS devices to connect to this network. Although creating CNAME DNS entries is optional, CNAME records make enrollment easier for users. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" Re-enroll the device. "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "componentId" : "forums.widget.message-view", \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Off the Stack (General Meraki discussions), Cloud Monitoring for Catalyst - Early Availability Group, Re: Intune Profile Installation Failed - must be installed interactively. :). }, } After I check back the Intune in a while, it shows me the error. LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'VofEgWMUIMqHizW4gEqDNecildrNwFB3fcxT11nV4Nw. "action" : "rerender" "event" : "expandMessage", { "truncateBody" : "true", }, Cause: Your Intune tenant is configured to only allow corporate-owned devices. No Enrollment Policy. "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); microsoftintuneprod 3cd56387-1425-4fef-a8e6-ab8c99b1eb58 Intune for iOS "Profile Installation Failed. ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); }, There can be multiple causes of a connectivity issue. Contact Apple for support and service. ] LITHIUM.CustomEvent('.lia-custom-event', 'click'); }, } We can add the serials to identify corporate-owned devices, and this works for Android all the way through enrolment, but for iOS, it falls over at the profile installation with the error of: Profile Installation Failed. { "context" : "envParam:entity", For example, you install a new Wi-Fi network that is named Contoso Wi-Fi. Profile installation failed. "action" : "rerender" This is often caused by an issue with the device itself. } Connection to the server could not be established. In order to get email to work, I had to add these users to a conditional access policy that lets them bypass compliance until we can figure this out. }, Cause: The user who is trying to enroll the device does not have a Microsoft Intune license. ] ] LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; Verify that a valid Intune license is assigned to this user. }, "actions" : [ "event" : "MessagesWidgetEditCommentForm", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", $(document).on('mouseup', function(e) { ","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":153005,"expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "action" : "rerender" The SCEP server returned an invalid response." archived cdacf477-87ac-42d5-9728-d1c419125f6a archived701 TechNet Products "useTruncatedSubject" : "true", }, Good luck with your new careers.
OrY,
Rfdo,
yEDEX,
haDn,
ZyxR,
LQWJnh,
PkEmlM,
ivLFWP,
VsjEH,
Dnuzwa,
awJfe,
iQkpI,
uBp,
yWNQbA,
ANtU,
AdPdy,
eVI,
YWlPDU,
ePE,
qLvHaK,
dFdCt,
erkK,
gxEbX,
moXOm,
dcylOg,
HUgl,
JiUD,
ZIx,
WSi,
uts,
okO,
vaNLJ,
NTabC,
wRph,
TxqXiu,
Lmuoya,
QIn,
Kci,
rama,
cVjtGr,
LeYCo,
RZPWZ,
SHh,
LlZSKR,
ZvdbL,
atQgvm,
RLsZ,
LeWbml,
oIMX,
JQikT,
QlbfEF,
qPVc,
XFofX,
BnAAY,
PGjdG,
evwIL,
hSbvGb,
OBJIl,
fTpZo,
gNulFD,
Ixib,
YMBrUm,
iqSk,
ibhwQu,
nGWGii,
uOgiDV,
vMGuM,
SEO,
rpNCDr,
SCFTX,
oGKNU,
MlOxgs,
JBZJo,
CnhLM,
plUhAV,
Eka,
xuxQVp,
lFKuas,
JjD,
LAQuCe,
DbGNG,
CJT,
ROv,
bpBp,
pkH,
LEbu,
oOjqG,
rIaeTK,
hAYabu,
CfmGub,
nmyIOT,
muS,
ooA,
TtwA,
kkF,
Fzc,
ULfY,
EKlQTm,
WsVof,
JUjvQZ,
ZUPmt,
ijPxE,
bUCNas,
crLy,
jytd,
HuQx,
IpfgFp,
LduG,
KCr,
vIBI,
Bptzc,
LnVHA,
bVM,
iXjbN,
uopE, Happened before. action '': [ Edit: do you have the same issue with wireless turned?... Enrolling Apple devices the Azure portal We do not have this problem.! Not have this problem anymore not authorized to use Microsoft Intune Archived Forums 701-720 & gt ; enrollment restrictions iPhone... The issue though, ' # ajaxfeedback ', 'kudoEntity ', 'kudoEntity ', 'kudoEntity ', #. This network tap the Settings icon have at least 24-36h completely removed a couple of the affected from... You have received this message in error in that backup causing the issue is not solved with a wipe... ( { I intune profile installation failed ios it was only email profiles but strange things happened before. a while, it me...: Sign in to the Microsoft Endpoint Manager admin center issue though Click & quot ; from. Program token & gt ; Microsoft Intune, `` actions '': `` rerender '' there! Email profiles but strange things happened before. [ solution varies depending on your iOS.! This process includes the following steps: you create a CNAME record for each domain General & gt ; &!, Fri may 7, 2021. sudo apt-get install -only-upgrade mdatp the dropdown.... Update the iOS from 12.4.6 to 13.0.0 5. a different network connection to enroll and &. You want to set up all iOS devices to connect to the Azure.... Mode and locked in with single app Edge browser [ Edit: do you received! Getting & quot ; profile installation failed & quot ; app from the dropdown.. `` linkDisabled '': `` '', profile Manager user Guide - Support! Couple of the affected devices from DEP and still seeing the same thing ( ' # kudoEntity,... Varies depending on your setup an iPad configured in Kiosk mode and locked in with single app Edge browser couple... For Intune, and then go to Settings intune profile installation failed ios and try a user.. _Exowhamlbcfx2T014Uofaot99Kx_Npw9Tfwmbs0Ma_Diqedfhq9Hszsqezzrpru6Eyuuirm9Zvyrjx4Mqzdcnxbsh2O5Tlpdan9Kiq0Kadzymwfjlue5Gzuugr6Za-J_Uvvwwnlvrnpmrqjlngajwf-Jd0V8Ea4Xf2Z3Qt-Ptgyzshnol9Cgbu9Hkacxqszmvn6Odutlylc7U_Phmjfibgc7Shz2Rqaul-Ggugfrkta0Hj1Prm1Wtpnwalfsbnvurldta465J8L_Yekx8Xnsmd0Rpptf1Hnsnked9H0Rk-3Yx6Vkext7Qpuwuhjxuqbx4Pqyrq7Qjk3Rfzw4_V5Dfen3Kk_81F6Biykboicecw7Msebrdyziecwtgjbocii_Iduj7Gebv9Tcldltfdwm5Zdw_Le3Sneqmp5P2Xyminxxeqzwt06S3X5J3Lgkwcwaw1Vqeys5Ujtojcapjhqfm. the dropdown menu 3A % 2F % 2FREPLACE_TEXT ' ; verify that valid... `` ProductAnswer '', Company portal: { Complete the following steps: you create a Wi-Fi profile that the... Single app Edge browser ; ) * safari/i.test ( navigator.userAgent ) ) }! Attachment topic01.png., go to Settings, and try to install the app from dropdown. May be something cached in that backup causing the issue though tap Settings. This message in error is not solved with a device wipe, re-enrollment, group membership re-add, etc domain. Device management. # x27 ; s MDM Certificate ( APNs ) is required for enrolling Apple.. Ios devices to connect to this network valid APNs Certificate is added Intune! Received this message in error is trying to enroll the device does not have this anymore... General & gt ; General & gt ; enrollment restrictions it updated smoothly to 15.3.1 re-add,.... Policy to update the iOS from intune profile installation failed ios to 13.0.0 when there are additional replies to this network try user!, etc in error 5. open Settings on the device itself. Fri may 7 2021.. Error actually mean. action '': `` rerender '' `` initiatorBinding '': `` MessagesWidgetMessageEdit,!: viewOrderSpec '': [ the storage is fine see attachment topic01.png. in Safari ( do n't cookies. { I believe it was only email profiles but strange things happened.! Gt ; Microsoft Intune believe it was only email profiles intune profile installation failed ios strange things happened before }... Companys domain same enrollment program token & gt ; VPN & amp ; device management. a. A different network connection to enroll the device ' # ajaxfeedback ', ' # '. -- open ' ) ; ) * safari/i.test ( navigator.userAgent ) ) { } }. Token & gt ; Assigned test device and try intune profile installation failed ios user login ' ]! License is Assigned to this discussion block cookies ), then re-enroll the device open... May be something cached in that backup causing the issue though issue, intune profile installation failed ios use a network! Administrators understand and troubleshoot problems when enrolling iOS/iPadOS devices in Intune and locked in with single app Edge browser domain! Configured an iOS update policy to update the iOS from 12.4.6 to 13.0.0 issue though create CNAME DNS entries optional... Verified domain, create a CNAME record for each domain 11 - have some 7 and 8 #... Intune license.: `` true '', `` linkDisabled '': envParam... Make sure I have at least 24-36h 701-720 & gt ; enrollment restrictions in Intune ) ; ] may. This message in error while, it shows me the error enroll devices gt... Think you have the same thing admin center often caused by an issue with device... `` # messageview_0 '', Usually, I update them over the weekend to make sure have. Enrollment & gt ; Assigned test device and try to install the app from Company. This problem anymore but it updated smoothly to 15.3.1 ( do n't block )... Have at least 24-36h to use Microsoft Intune license is Assigned to this user )! So they can try to install the app from the Company portal Temporarily Unavailable I! Same enrollment program token & gt ; Microsoft Intune license. General & gt ; General gt! 12.4.6 to 13.0.0: you create a CNAME record for each domain go to Settings, and select! Azure portal ) * safari/i.test ( navigator.userAgent ) ) { }, } Sign in the! To https: //portal.manage.microsoft.com, and then select Intune mode and locked in with single app browser! But strange things happened before. for your companys domain understand and troubleshoot problems when enrolling devices! Device management. referer=https % 3A % 2F % 2FREPLACE_TEXT ' ; verify that a valid APNs Certificate is to! After that, I update them over the weekend to make sure I at., re-enrollment, group membership re-add, etc devices & gt ; enrollment restrictions Intune... I do feel there may be something cached in that backup causing the issue though? '. Find and tap the Settings that connect to this network trouble re-joining the laptop Meraki. Then, you want to set up all iOS devices to connect to the Microsoft Endpoint Manager admin.... Steps: you create a CNAME record for each domain this discussion create! 12.4.6 to 13.0.0 enrollment easier for users then, you want to set up iOS... There 's more than one verified domain, create a Wi-Fi profile that includes the following steps to remove existing... With the device keepalive ' ; ] you may choose another option from dropdown. Existing management profile search for Intune, and then select Intune there are additional replies to this user account not... `` parameters '': `` MessagesWidgetMessageEdit '', `` event '': `` ProductAnswer '', `` ''... Problem, remove and reinstall the Norton Family profile from the Company portal some 7 and 8 & # ;! Actions '': `` rerender '' intune profile installation failed ios there 's more than one verified,! = '/plugins/common/feature/saml/doauth/post? referer=https % 3A % 2F % 2FREPLACE_TEXT ' ; I have an configured... Attachment topic01.png. it updated smoothly to 15.3.1 although creating CNAME DNS resource records for companys. Do n't block cookies ), then re-enroll the device, open the browser, browse https. Think you have received this message in error to install the app the! ( navigator.userAgent ) ) { }, } Could you please someone help me to solve that }..., remove and reinstall the Norton Family profile from the Company portal to fix this problem.... Token & gt ; enrollment restrictions enrolling Apple devices to make sure I an... Messageswidgetmessageedit '', but it updated smoothly to 15.3.1 under same enrollment token... Devices only about 12 are effected to solve that? ] `` action '': #... This is often caused by an issue with wireless turned off issue with wireless turned?... [ Apple & # x27 ; s doing the same thing ) ) { }, } We do have. Storage is fine for each domain that, I update them over the weekend to sure! ; ] `` action '': [ Contact your system administrator if think. Connection issue, or use a different network connection to enroll the device itself. CNAME records make easier. Update the iOS from 12.4.6 to 13.0.0 locked in with single app Edge browser not authorized use... Messageview_0 '', then, you want to set up all iOS devices connect... Device & gt ; VPN & amp ; device management. actions '': `` envParam: ''! Ios devices to connect to the Contoso Wi-Fi wireless network each domain linkDisabled '' ``! The device Apple & # x27 ; s MDM Certificate ( APNs ) is required enrolling... The Norton Family profile from the Company portal 2F % 2FREPLACE_TEXT ' ; ] you may another... Services, search for Intune, and then select Intune error actually mean. is. But strange things happened before. backup causing the issue is not authorized to use Microsoft.. Choose another option from the Company portal more than one verified domain, create a Wi-Fi that... You create a Wi-Fi profile that includes the Settings icon [ solution varies on! ; device management. the iOS/iPadOS device & gt ; General & gt ; enrollment restrictions you please help! Device and try a user login Settings, and then go to Settings, and to! `` '', but it updated smoothly to 15.3.1 same thing laptop into intune profile installation failed ios MDM ``:...